PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.SEJ3V
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 362aa    MW: 41152 Da    PI: 4.4936
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.SEJ3VgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.2e-19101154356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k++++t+eq++ Le+ Fe+++++  e++ +LAk+lgL+ rqV +WFqNrRa+ k
  Aradu.SEJ3V 101 KKRRLTSEQVQFLERSFEMENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFK 154
                  6679************************************************98 PP

2HD-ZIP_I/II127.65.2e-41101192293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  kkrrl++eqv++LE+sFe+e+kLeperKv+la+eLglqprqva+WFqnrRAR+ktkqlEk+y aLk+++d+lk + e+L +++++L++e+++
  Aradu.SEJ3V 101 KKRRLTSEQVQFLERSFEMENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKTKQLEKEYGALKASFDKLKGDYESLLQQNDKLKQEVNA 192
                  9**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-2087158IPR009057Homeodomain-like
PROSITE profilePS5007117.84896156IPR001356Homeobox domain
SMARTSM003893.5E-1899160IPR001356Homeobox domain
CDDcd000861.78E-17101157No hitNo description
PfamPF000463.6E-16101154IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-19102163IPR009057Homeodomain-like
PRINTSPR000316.0E-6127136IPR000047Helix-turn-helix motif
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PRINTSPR000316.0E-6136152IPR000047Helix-turn-helix motif
PfamPF021836.9E-16156197IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MASGKLYGGS SMSLLLQNES RLPSSSQVLD SLWLHTSDPS SFQGSKNMVV DFENGRGSSI  60
RDRSFFQQGL IEKEENNNNG CDDDYDPSCF QQTGSNGGNS KKRRLTSEQV QFLERSFEME  120
NKLEPERKVQ LAKELGLQPR QVAIWFQNRR ARFKTKQLEK EYGALKASFD KLKGDYESLL  180
QQNDKLKQEV NALRNKLIPR DKEDENCSSD EKSSPQDVDT INSNHNKEED EPVMMELMIS  240
NSTSNENGSK MPLPHPIILT CKQEDANSAK SDVLDDSADS PHCTNNGNHV HHHHHFSSFM  300
EEEPADSDDF SQDDDDNLSE NLLTLPCLPK VEDNDACYHE QNENTCGFGF PVEDQTFCFW  360
PY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148156RRARFKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015965387.10.0PREDICTED: homeobox-leucine zipper protein ATHB-20-like
TrEMBLA0A0B2NVJ11e-153A0A0B2NVJ1_GLYSO; Homeobox-leucine zipper protein HAT5
TrEMBLI1J5K21e-153I1J5K2_SOYBN; Uncharacterized protein
STRINGGLYMA01G04890.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15003499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-41homeobox 1